Marketing Technology Manager
Daytonhybridmanager$10K – $17K
Posted yesterday · via Smartrecruiters
About this role
About INSPIRING A BETTER WAY OF LIVING ACCESSIBLE TO ALL As the preferred partner for window and door automation, SOMFY is committed to inspiring new and better ways of living for all. As a French, family-owned, and independent group, in continuous growth since our creation, we have been world leaders for 50 years and pioneers in home automation. Innovation continuously guides our work and guarantees the excellence of our solutions. We are present in 58 countries, with eight production sites and 17 R&D centers. We are deeply committed to the well-being of our 7,000 employees, we promote their sustainable employability by promoting internal mobility and developing their skills. We foster diversity and inclusion by building on our strong corporate culture.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, r, html, css…
2
Level fit
This role is manager-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Dayton. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphprhtmlcssmysqlteamssalesforce
More at Somfy Group
- View →Architecte - Systeme Solution (H/F)Cluses, Auvergne-Rhône-Alpes, France
- View →Responsable Prix de Transfert GroupeCluses, Auvergne-Rhône-Alpes, France
- View →Data Scientist Senior (H/F)Annecy, Auvergne-Rhône-Alpes, France
- View →Responsable Régional Installateurs - Normandie - H/FCaen, Normandy, France
- View →Responsable Régional Installateurs - Centre - H/FOrléans, Centre-Val de Loire, France
- View →Commercial Sédentaire H/FCluses, Auvergne-Rhône-Alpes, France
