S
Somfy GroupMarketing

Marketing Technology Manager

Daytonhybridmanager$10K$17K

Posted yesterday · via Smartrecruiters

About this role

About INSPIRING A BETTER WAY OF LIVING ACCESSIBLE TO ALL As the preferred partner for window and door automation, SOMFY is committed to inspiring new and better ways of living for all. As a French, family-owned, and independent group, in continuous growth since our creation, we have been world leaders for 50 years and pioneers in home automation. Innovation continuously guides our work and guarantees the excellence of our solutions. We are present in 58 countries, with eight production sites and 17 R&D centers. We are deeply committed to the well-being of our 7,000 employees, we promote their sustainable employability by promoting internal mobility and developing their skills. We foster diversity and inclusion by building on our strong corporate culture.…

Read the full description on Somfy Group's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, r, html, css…

2

Level fit

This role is manager-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Dayton. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphprhtmlcssmysqlteamssalesforce

More at Somfy Group

See all open jobs at Somfy Group