UI/UX Designer

Chantillyonsitemid

Posted 2w ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About Founded in 1989 and headquartered in Reston, Virginia, SOSi is a private defense and government solutions business specializing in advanced technology systems and mission support. Its capabilities include data science, software development, network engineering, intelligence, surveillance, and reconnaissance (ISR), and logistics. *Position is contingent upon contract award* SOSi is seeking a UI/UX Designer. The UI/UX Designer will provide user interface/user experience to design, research, and development plans in support of the Sponsor's applications. The Designer will leverage expertise in UI/UX design principles, human-centered design, and user research to create intuitive and user-friendly digital experiences.…

Read the full description on Sosi1's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, html, css, figma, sketch…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Chantilly. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascripthtmlcssfigmasketchinvisionteams

More at Sosi1

See all open jobs at Sosi1 →