Senior Software Engineer

PL Warsaw Workspaceonsitesenior

Posted yesterday · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Description: SPS Commerce is a leading provider of cloud-based supply chain management solutions, serving a global network of retail trading partners. We foster a collaborative and inclusive work environment where innovation and continuous improvement are highly valued. Join SPS Commerce and be part of a dynamic team that's transforming the global retail supply chain! Position Summary: We are searching for a Senior Software Engineer based in Poland to design, build, and maintain high-volume, event-driven back-end services and data pipelines for our Fulfillment platform.…

Read the full description on SPS Commerce's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: typescript, python, react, vue, angular…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in PL Warsaw Workspace. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptpythonreactvueangularfastapimysqlelasticsearchsnowflakeauroraawsgcpsnskinesiskubernetesdockerterraformsumo logicgrafanakafkarabbitmqclaudegitgithub

More at SPS Commerce

See all open jobs at SPS Commerce →