S
StackadaptPlatform Engineering

Motion Design Technologist

Canada; United Statesonsite

via Greenhouse

About this role

StackAdapt is the leading technology company that empowers marketers to reach, engage, and convert audiences with precision. With 465 billion automated optimizations per second, the AI-powered StackAdapt Marketing Platform seamlessly connects brand and performance marketing to drive measurable results across the entire customer journey. The most forward-thinking marketers choose StackAdapt to orchestrate high-impact campaigns across programmatic advertising and marketing channels. Engineering at StackAdapt As an engineer at StackAdapt, you’ll build production-level software that directly impacts our advertising platform. You’ll work with modern stacks across Go, Ruby on Rails, React, GraphQL, and more.…

Read the full description on Stackadapt's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, go, ruby, css, react…

2

Level fit

We check your title trajectory against the seniority signal of the role.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Canada; United States. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptgorubycssreactrailsgraphqlfigmateams

More at Stackadapt

See all open jobs at Stackadapt