Software Engineer - Web

Memphisonsitemid$78K – $139K

Posted 2w ago · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Job Overview: The Department of Pathology is seeking a Software Engineer to develop and maintain web-based tools that support clinical molecular diagnostics, with an emphasis on interactive data visualization and graphical interfaces for pathologist review and clinical reporting. Job Description: The Software Engineer is responsible for developing web-based tools for new clinical laboratory testing strategies under direct supervision. The role centers on turning sequencing outputs and other assay data into intuitive, review-ready visualizations that pathologists and clinical analysts can use to interpret results, document findings, and generate clinical reports.…

Read the full description on Stjude's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, php, sql, html, css…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Memphis. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqlhtmlcsslaravelrestfulpostgresqlmysqlawsazurerenderdockergit

More at Stjude

See all open jobs at Stjude →