Frontend Product Engineer

mid$160K$210K

via Ashby

About this role

About Tacit We are an early-stage, deep tech startup based in San Francisco, developing innovative hardware that rethinks human-computer interaction. We are backed by General Catalyst, Khosla Ventures, and Greylock Partners, with a founding team from Stanford, BrainGate, Oculus, and Tesla. While we can’t reveal too much just yet, our team is tackling cutting-edge engineering challenges to bring revolutionary products to life. ABOUT THE ROLE We are looking for a frontend product engineer to turn early ideas, prototypes, and design explorations into magical user-facing experiences. This is our first dedicated frontend hire: the interfaces you build are how people will actually experience silent speech.…

Read the full description on Tacit's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, swift, react, figma, sketch

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in a specific location. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptswiftreactfigmasketch

More at Tacit

See all open jobs at Tacit