Assoc Director, Enterprise Applications - Digital & Marketing Systems
Irvineonsitedirector$165K – $231K
via Greenhouse
About this role
About the Role:
As the Associate Director, Enterprise Applications - Digital & Marketing Systems, you will serve as a strategic technology leader responsible for identifying, implementing, and optimizing digital and marketing technology solutions that support Tarsus’ commercial strategy. In this role, you will partner closely with marketing and cross-functional commercial teams, agencies and service providers to drive omnichannel engagement, website operations, marketing analytics, and customer experience initiatives that increase awareness and adoption of Tarsus treatments.
Let’s talk about some of the key responsibilities of the role:
Thrive in a fast-paced, innovative environment while demonstrating flexibility, accountability, and a proactive mindset.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, sql, html, css, teams…
2
Level fit
This role is director-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Irvine. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptsqlhtmlcssteamshipaasalesforce
More at Tarsusrx
- View →Manager II, ComplianceIrvine, California, United States
- View →Manager II, Regulatory AffairsIrvine, California, United States
- View →Sr Clinical Research Associate (CRA)Irvine, California, United States
- View →Sr Scientist - Analytical DevelopmentIrvine, California, United States
- View →Sr Director, Professional RelationsIrvine, California, United States
- View →Manager II, Clinical Quality AssuranceIrvine, California, United States