reqspace
Start free trial →
T
TD Bank

IT Developer (Java), TD Securities

Torontoonsitemid$67K – $72K

Posted 2w ago · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Work Location: Toronto, Ontario, Canada Hours: 37.5 Line of Business: Technology Solutions Pay Details: $91,500 - $98,400 CAD This role is eligible for a discretionary variable compensation award that considers business and individual performance. TD is committed to providing fair and equitable compensation opportunities to all colleagues. Growth opportunities and skill development are defining features of the colleague experience at TD. Our compensation policies and practices have been designed to allow colleagues to progress through the salary range over time as they progress in their role. The base pay actually offered may vary based upon the candidate's skills and experience, job-related knowledge, geographic location, and other specific business and organizational needs.…

Read the full description on TD Bank's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, rails, spring, spring boot, grpc…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Toronto. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonrailsspringspring bootgrpcrestfulmongodbdatabricksjenkinssparkpysparkkafkapandasgitteamsgradlemavenoauthoidc

More at TD Bank

See all open jobs at TD Bank →