Partner Manager, ANZ
Sydneyonsitemanager
via Greenhouse
About this role
About Teads Teads is a leading omnichannel advertising platform building the future of digital advertising where quality content, trusted publishers, ambitious brands, and human creativity can thrive. Operating at true scale - processing 18 billion ad opportunities every single day - we connect global brands with a monthly reach of over 2.2 billion unique users. At Teads, we believe your impact travels further . We are a borderless team of 1,700+ innovators across 30+ countries who favor outcome over tenure, value trusted autonomy, and use predictive AI to amplify human ingenuity rather than replace it. We move at pace, tackle genuinely complex problems, and foster a high-accountability culture that stays genuinely human.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, r, sql, html, css…
2
Level fit
This role is manager-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Sydney. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptrsqlhtmlcssteamssalesforce