PHP Developer
Hyderabadonsitemid
Posted 126mo ago · via Smartrecruiters
About this role
About TMI is a 25 year old full service HR Consulting firm headquartered in Hyderabad and having presence across all major cities in the country. The group, comprising of three different entities, has about 300 full time employees, and services client requirements across all major economic sectors. You can learn more about the group from http:///tmigroup.in Employment Equity TMI is an equal opportunity employer and employs personnel without regard to race, ancestry, place of origin, colour, ethnic origin, language, citizenship, creed, religion, gender, sexual orientation, age, marital status, physical and/or mental handicap or financial ability. 24 Months Commitment The TMI HR Policies require a 24 months commitment of association from its full time employees.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, html, css, laravel…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Hyderabad. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphphtmlcsslaravelmysqlmondayxml
More at Tminetwork
- View →Urgent Requirement for Recruiter(Recruitment Support Executive)-Mumbai,Delhi,Bangalore,ChennaiHyderabad, Telangana, India
- View →. Net DeveloperSecunderabad, AP, , India
- View →Regional Sourcing ManagerMumbai, MH, India
- View →Research Executive / ManagerHyderabad, Telangana, India
- View →Training ManagerHyderabad, Telangana, India
- View →Learning and Development ManagerHyderabad, Telangana, India
