Legal Technology Entry-Level Developer
Myrtle Beachhybridjunior
Posted 1w ago · via Recruitee
About this role
Legal Technology Entry-Level Developer Overview TransPerfect is seeking motivated and tech-savvy Entry-Level Developers to join the team supporting Virtual Reef, TransPerfect’s internal business platform. This role is ideal for early-career professionals who are passionate about software development, problem-solving, and building scalable technology solutions in a collaborative environment. We are looking for candidates with experience or academic exposure to web development technologies, databases, front-end frameworks, or QA automation platforms. Successful candidates will be eager to learn, adaptable, and excited to contribute to innovative internal tools and applications.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, react, mysql, git…
2
Level fit
This role is junior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Myrtle Beach. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphpreactmysqlgitteams
More at Trans Perfect
- View →Account ManagerVancouver, Canada
- View →Interpreter Project CoordinatorCDMX, Mexico
- View →Account ManagerRaleigh, United States
- View →Translation Project AssistantBuenos Aires, Argentina
- View →Sales Enablement SpecialistAtlanta, United States
- View →Senior Backend Developer (C# .NET)London, United Kingdom