UatalentsInformation Technology

BackEnd Developer for AddApptr GmbH

Hamburgonsitemid

Posted 50mo ago · via Smartrecruiters

See if I'm a fit →Tailor my resume for this role →Apply on Smartrecruiters ↗

About this role

About We are looking for a Backend Developer (f/m/d) to join our engineering team in the beautiful city of Hamburg! AddApptr manages billions of transactions and requires a highly performant and flexible backend system. As a Backend Developer (f/m/d) at AddApptr you will play a key role in developing the fastest and most reliable solution for mobile advertising. About AddApptr: AddApptr offers a premium mobile programmatic advertising solution for large app publishers. At its core, AddApptr is a tech company. Billions of ad impressions are delivered each month via the AddApptr Meta-RTB solution, creating millions of Euros in advertising revenues for AddApptr publishers.…

Read the full description on Uatalents's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: javascript, php, sql, html, mysql…

Level fit

This role is mid-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Hamburg. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqlhtmlmysqlmariadbredisclickhouseteamsjsonxml

More at Uatalents

See all open jobs at Uatalents →