Senior Frontend Engineer
remotesenior
via Ashby
About this role
In this role, you will lead the frontend engineering at Umbrel, and own major product surfaces in umbrelOS (web UI), our first-party apps, and our website.
We hope you are someone who:
- Treats Figma as a contract you’ll honor in code, and you’ll improve it when the reality demands.
- Ships polished, accessible interfaces in React + TypeScript (Tailwind, Shadcn, Radix).
- Sweats the last 5%: empty states, errors, skeletons, loading strategies, and microcopy that reduces cognitive load.
- Uses motion to communicate state (not decorate it): consistent easing/durations and meaningful transitions.
- Thinks in systems: API-design, theming, responsive scales, and components that age well.
- Writes clear, readable code and tests, and leaves the codebase calmer than you found it.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, react, tailwind, shadcn, figma
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptreacttailwindshadcnfigma