Software Engineer, Distribution Platform
United States · RemoteRemote (US)mid
via Greenhouse
About this role
About Upstart
At Upstart, we’re united by a mission that matters: to radically reduce the cost and complexity of borrowing for all Americans. Every day, we bring creativity, experimentation, and advanced AI to reshape access to credit, helping millions move forward financially with clarity and confidence.
As the leading AI lending marketplace, we partner with banks and credit unions to expand access to affordable credit through technology that’s both radically intelligent and deeply human. Our platform runs over one million predictions per borrower using more than 3,000 signals, powering smarter, fairer decisions for millions of customers. But the numbers only hint at the impact.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, python, java, ruby…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptpythonjavarubykotlinsqlreactrailsawsgcpsparkteamsoutreach
More at Upstart
- View →Staff AnalystUnited States | Remote
- View →Finance Manager, Bank FinanceUnited States | Remote
- View →Senior Manager, Loan Salability & First-Line Model GovernanceUnited States | Remote
- View →Senior Product Manager, ASPLUnited States | Remote
- View →Senior Software Engineer, PricingUnited States | Remote
- View →Senior Security Engineering Manager, Enterprise SecurityUnited States | Remote
