Senior Software Engineer

Aventuraonsitesenior$176K – $196K

via Greenhouse

See if I'm a fit →Tailor my resume for this role →Apply on Greenhouse ↗

About this role

At Compass, our mission is to help everyone find their place in the world. Founded in 2012, we’re revolutionizing the real estate industry with our end-to-end platform that empowers residential real estate agents to deliver exceptional service to seller and buyer clients. At Compass International Holdings (CIH), we connect buyers and sellers with the right agents at the right time. The Lead Nurturing & Engagement team is responsible for keeping leads warm and actionable before they are assigned to an agent — ensuring no qualified lead goes cold due to slow response, lack of follow-up, or poor timing. We own the full pre-CRM nurturing funnel: from the moment a lead enters the system to the moment it is ready to be handed off to an agent.…

Read the full description on Urbancompass's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, java, go, nodejs, grpc…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in Aventura. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonjavagonodejsgrpcawskafkalangchainllamaindexopenaianthropicbedrockteamsmavensalesforcehubspotoutreach

More at Urbancompass

See all open jobs at Urbancompass →