V
velpTECContent Production

Softwareentwickler Moodle (m/w/d)

Remote (Deutschland)remote

via Personio

About this role

Über uns velpTEC ist ein auf innovative Technologien ausgerichtetes Weiterbildungsinstitut, das Erfahrungen aus Wirtschaft, Zukunftsforschung und neuen Bildungsansätzen verbindet. Wir unterstützen Menschen durch unsere Bildungsangebote praxisnah dabei, ihre Fähigkeiten für künftige Zeiten zu stärken und damit aktiv ihren Lebensweg zu gestalten. In unserem Handeln legen wir Wert auf gesellschaftliche Verantwortung, Fortschritt und Selbstbestimmung. Bereit für eine neue Mission? Dann entdecke jetzt deine Zukunftsperspektive bei velpTEC und werde Teil unseres multiprofessionellen und diversen Teams.…

Read the full description on velpTEC's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, r, html, css…

2

Level fit

We check your title trajectory against the seniority signal of the role.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphprhtmlcssmysqlteamsoauthsaml

More at velpTEC

See all open jobs at velpTEC