FullStack Developer
Austinonsitemid
Posted 1mo ago · via Teamtailor
About this role
About Virtasant Virtasant is a global technology services company with a network of over 4,000 technology professionals across 130+ countries. We specialize in cloud architecture, infrastructure, migration, and optimization, helping enterprises scale efficiently while maintaining cost control. Our clients range from Fortune 500 companies to fast-growing startups, relying on us to build high-performance infrastructure, optimize cloud environments, and enable continuous delivery at scale. About the role Our client develops a powerful AI-powered training and communication SaaS platform that gives frontline workers the knowledge they’re missing to drive measurable business performance.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, java, html, css…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Austin. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptjavahtmlcssreactmysqlgcplangchainclaudegithub
More at Virtasant
- View →Forward Deployed Engineer, AI & AnalyticsAustin, North America, US
- View →Director of Sales | Middle EastAustin, EMEA, US
- View →Senior Platform Engineer, Cloud InfrastructureAustin, North America, US
- View →Sales Development SpecialistAustin, North America, US
- View →Senior Solutions Architect - Cloud & AI OptimizationAustin, North America, US
- View →Senior Solutions Architect - Cost Optimization & AIAustin, North America, US
