FullStack Developer

Austinonsitemid

Posted 1mo ago · via Teamtailor

About this role

About Virtasant Virtasant is a global technology services company with a network of over 4,000 technology professionals across 130+ countries. We specialize in cloud architecture, infrastructure, migration, and optimization, helping enterprises scale efficiently while maintaining cost control. Our clients range from Fortune 500 companies to fast-growing startups, relying on us to build high-performance infrastructure, optimize cloud environments, and enable continuous delivery at scale. About the role Our client develops a powerful AI-powered training and communication SaaS platform that gives frontline workers the knowledge they’re missing to drive measurable business performance.…

Read the full description on Virtasant's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, javascript, java, html, css…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Austin. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptjavascriptjavahtmlcssreactmysqlgcplangchainclaudegithub

More at Virtasant

See all open jobs at Virtasant