(USA) Principal, Data Scientist

(USA) SUNNYVALE TECH CORNERS BLDG 6 CA SUNNYVALE Home Officeonsiteprincipal$143K – $286K

Posted today · via Workday

See if I'm a fit →Tailor my resume for this role →Apply on Workday ↗

About this role

Position Summary... What you'll do... Role summary: The Principal Data Scientist will lead the design, development, and deployment of AI-powered Search and Personalization solutions that serve millions of customers across global eCommerce platforms. This role combines deep expertise in machine learning, information retrieval, recommendation systems, and generative AI to solve complex customer discovery problems. You will partner closely with Product, Engineering, and Applied AI teams to define technical strategy, influence architecture, mentor senior scientists, and deliver scalable ML systems that improve customer experience and business outcomes.…

Read the full description on Walmart's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: python, scala, r, sql, aws…

Level fit

This role is principal-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is based in (USA) SUNNYVALE TECH CORNERS BLDG 6 CA SUNNYVALE Home Office. We weight your proximity and willingness to relocate.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonscalarsqlawssagemakersparktensorflowteams

More at Walmart

See all open jobs at Walmart →