Senior AI Engineer - Evisort AI
Canadaonsitesenior$123K – $185K
Posted today · via Workday
About this role
Your work days are brighter here. We’re obsessed with making hard work pay off, for our people, our customers, and the world around us. As a Fortune 500 company and a leading AI platform for managing people, money, and agents, we’re shaping the future of work so teams can reach their potential and focus on what matters most. The minute you join, you’ll feel it. Not just in the products we build, but in how we show up for each other. Our culture is rooted in integrity, empathy, and shared enthusiasm. We’re in this together, tackling big challenges with bold ideas and genuine care. We look for curious minds and courageous collaborators who bring sun-drenched optimism and drive.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, python, react, django, fastapi…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Canada. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptpythonreactdjangofastapirestpostgresqlredisawsazuregcpsqskubernetesdockerhelmterraformdatadogsentrygrafanaopentelemetrykafkalangchainllamaindexteams
More at Workday
- View →Sales Development Representative | GermanIreland, Dublin
- View →Director, Content & Tenant BuildIreland, Dublin
- View →Cybersecurity Engineer - US FederalUSA.VA.Reston
- View →Solution Consultant - FIN- Tech & MediaUSA, CA, Remote
- View →IT Risk Manager, BT Risk ManagementUSA, CA, Pleasanton
- View →IT Risk Principal, BT Risk ManagementUSA, CA, Pleasanton
