Software Engineer V, Forward Deployed

Rockvilleonsitemid$195K$220K

Posted 1w ago · via Workday

About this role

X-energy LLC conducts a thorough recruiting process and will never issue offers without interview to discuss qualifications and responsibilities. All applications will be submitted via our company career page, www.x-energy.com/careers/ . We will never ask you to provide payment information as part of the recruiting process. If anyone claiming to represent X-energy directs you in a manner otherwise, please contact us at www.x-energy.com/contact-us . Job Description This senior-level role serves as a strategic technical leader and organizational bridge between X‑energy’s APEX platform development team and high‑impact stakeholders across the company.…

Read the full description on Xenergy's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, javascript, css, react, tailwind…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Rockville. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptjavascriptcssreacttailwindvitedynamodbawslambdaecsdockerterraformlangchainbedrockgitlabmondayteamsworkday

More at Xenergy

See all open jobs at Xenergy