Software Engineer V, Forward Deployed
Rockvilleonsitemid$195K – $220K
Posted 1w ago · via Workday
About this role
X-energy LLC conducts a thorough recruiting process and will never issue offers without interview to discuss qualifications and responsibilities. All applications will be submitted via our company career page, www.x-energy.com/careers/ . We will never ask you to provide payment information as part of the recruiting process. If anyone claiming to represent X-energy directs you in a manner otherwise, please contact us at www.x-energy.com/contact-us . Job Description This senior-level role serves as a strategic technical leader and organizational bridge between X‑energy’s APEX platform development team and high‑impact stakeholders across the company.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, javascript, css, react, tailwind…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Rockville. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptjavascriptcssreacttailwindvitedynamodbawslambdaecsdockerterraformlangchainbedrockgitlabmondayteamsworkday
More at Xenergy
- View →Engineer I–III, Thermal-Hydraulic Safety Analysis & V&VRockville, MD
- View →Project Engineer IIIOak Ridge, TN
- View →Test Manager, Helium Test FacilityRockville, MD
- View →Systems Administrator IV, Enterprise Content ManagementRockville, MD
- View →Corrective Action SpecialistOak Ridge, TN
- View →Senior Manager, Brand MarketingRockville, MD
