Senior Data Scientist II
United Statesonsitesenior$162K – $203K
via Greenhouse
About this role
Own the development of advanced modeling solutions that enable Zip’s next generation of financial products, leveraging rich data sources such as bank transaction data to unlock new product capabilities while strengthening the core business. Bring deep data science, applied research, and financial services expertise to develop and experiment with innovative modeling approaches—including traditional machine learning, algorithmic solutions, and AI-centric techniques—that balance risk, profitable growth, and long-term product opportunity.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: python, sql, render, pyspark, git…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in United States. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
pythonsqlrenderpysparkgitteamsplaid
More at Zipco
- View →Not Seeing the Right Role? Join Our Talent Community!United States
- View →Technical Delivery ManagerUnited States
- View →Senior AI Fullstack EngineerMelbourne; Sydney
- View →Senior Product Manager, Customer Engagement & Digital FoundationsMelbourne; Sydney
- View →Director of External CommunicationsUnited States
- View →Sr. Partner, Credit, Model & Fraud Risk OversightUnited States