Pessoa Cientista de Dados Sênior

Remotoonsite

via Greenhouse

About this role

Nosso propósito é criar tecnologias que desafiam as melhores do mundo e mudam o jogo para nossos clientes. Por isso, buscamos profissionais que desejam fazer parte de uma cultura pautada pela excelência e inovação. Se você se identifica com um ambiente de trabalho colaborativo e movido por curiosidade, venha construir o futuro da tecnologia conosco. O que você fará por aqui Apoiar decisões técnicas e de produto como referência em Machine Learning/Inteligência Artificial, com forte ênfase em NLP (Processamento de Linguagem Natural) e LLMs (Large Language Models). Desenhar, implementar e manter pipelines de dados e ML, cobrindo treinamento, avaliação e inferência, sempre com foco em performance, confiabilidade e boas práticas.…

Read the full description on Zupinnovation's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: python, opensearch, pinecone, aws, kinesis…

2

Level fit

We check your title trajectory against the seniority signal of the role.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Remoto. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

pythonopensearchpineconeawskinesisemrsparkscikit-learnpytorchtensorflow

More at Zupinnovation

See all open jobs at Zupinnovation