Senior AI-Native Fullstack Engineer (m/f/d) - DevOps

Remote · Münchenremotesenior

via Personio

See if I'm a fit →Tailor my resume for this role →Apply on Personio ↗

About this role

Job description We are looking for a Senior AI-Native Fullstack Engineer with a DevOps focus to support multiple engineering projects across AI-powered applications, SaaS platforms, and cloud-native solutions. This is not a traditional DevOps-only role. The role combines application engineering with infrastructure ownership: building services, APIs, automation and internal tools, while also running cloud infrastructure, deployments, observability and production operations. The ideal profile is a strong fullstack or backend engineer, preferably TypeScript-heavy, with hands-on depth in AWS, Infrastructure as Code, containers, networking, permissions, secrets and observability.…

Read the full description on Zvoove Group GmbH's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

Skills match

For this role: typescript, aws, ecs, fargate, iam…

Level fit

This role is senior-level. We check your trajectory against it.

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

Location fit

This role is remote-eligible — we factor in your stated location and time-zone overlap.

Score yourself on this role.

Free · no card · written explanation included

See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptawsecsfargateiamcdkclaudeteams

More at Zvoove Group GmbH

See all open jobs at Zvoove Group GmbH →