Senior AI-Native Fullstack Engineer (m/f/d) - DevOps
Remote · Münchenremotesenior
via Personio
About this role
Job description We are looking for a Senior AI-Native Fullstack Engineer with a DevOps focus to support multiple engineering projects across AI-powered applications, SaaS platforms, and cloud-native solutions. This is not a traditional DevOps-only role. The role combines application engineering with infrastructure ownership: building services, APIs, automation and internal tools, while also running cloud infrastructure, deployments, observability and production operations. The ideal profile is a strong fullstack or backend engineer, preferably TypeScript-heavy, with hands-on depth in AWS, Infrastructure as Code, containers, networking, permissions, secrets and observability.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: typescript, aws, ecs, fargate, iam…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is remote-eligible — we factor in your stated location and time-zone overlap.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
typescriptawsecsfargateiamcdkclaudeteams
More at Zvoove
- View →Medior Software DeveloperNL | Amersfoort - RecruitNow
- View →Koch (m/w/d)DE | Wietmarschen-Lohne
- View →Kopie vonFR | Paris
- View →Front-end DeveloperNL | Amersfoort - RecruitNow, Hybrid
- View →Teamleiter:in Lohnbuchhaltung/Payroll 80-100%CH | Basel, Remote
- View →Functioneel testerNL | Amersfoort - RecruitNow
