Senior Site Reliability Engineer
senior$200K – $225K
via Ashby
About this role
ABOUT THE ROLE
We’re looking for an experienced Site Reliability Engineer (SRE) to help us scale our platform with reliability, observability, and operational excellence at the core. You’ll partner with engineers and data scientists to build, automate, and maintain the infrastructure that powers our core platform—including data pipelines, ML workloads, and real-time analytics systems.
This is a hands-on, high-impact role with visibility across the stack and the opportunity to shape the future of our infrastructure and operations. We're hiring onsite in Dunwoody, GA.
KEY RESPONSIBILITIES
- Design, build, and maintain scalable infrastructure to support real-time analytics and machine learning workloads…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: shell, bash, aws, kubernetes, docker…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in a specific location. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
shellbashawskubernetesdockerterraformansiblegithub actionsdatadoggrafanaprometheusopentelemetryelksparkkafkaairflowgithubteams
