Staff AI Product Designer, Gemini Assistant
Mountain Viewonsitemid
via Greenhouse
About this role
Snapshot
The Gemini App Design team is instrumental in building the Gemini Universal Assistant, the conversational AI that people around the world use to collaborate with generative AI to fuel their imagination, expand their curiosity, and enhance their productivity. We're building innovative ways for people to get things done & enrich their lives. Our Design team is dedicated to developing the world's useful generative AI experiences.
About Us
At Google DeepMind, we aim to unlock state-of-the-art artificial intelligence capabilities across Alphabet, creating positive impact and magical product experiences for billions of users. We're a world-leading AI research company, pushing the boundaries of what's possible with artificial intelligence.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, gemini, figma…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Mountain View. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssgeminifigmasketchteams
More at Deepmind
- View →Senior Product Manager, Kaggle, North AmericaMountain View, California, US; New York City, New York, US; San Francisco, California, US
- View →Senior Program Manager, Google DeepMind Impact AcceleratorLondon, UK
- View →Senior PsychologistMountain View, California, US
- View →Senior Technical Program Manager, GeminiAppMountain View, California, US; New York City, New York, US
- View →Staff AI Product Designer, Growth & Discovery, GeminiAppMountain View, California, US; San Francisco, California, US
- View →Senior ML Software Engineer, GeminiApp Strategic User SegmentsMountain View, California, US