F
FocusitrecruitmentInformation Technology

Web Developer

Swanseaonsitemid

Posted 82mo ago · via Smartrecruiters

About this role

Web Developer The Company: Focus IT are pleased to assist this Nationwide company who offer services for their clients across the globe. The Role: Due to industry growth we now have a requirement for a hardworking software developer working with Laravel and Vue.js. Key responsibilities: · Design and develop some exiting websites · Cross talented developer, Maintenance, enhancements and new development The Candidate: The candidate will need to be highly resourceful and an innovative developer. With are looking for someone with a key eye for design, layout and strong knowledge of coding websites. Key skills are as follows: · PHP 7+ · Laravel – Proficiency · JavaScript ES6+ · Vuejs – Proficiency · AWS/Server knowledge · Sketch · HTML · SQL Database Web Developer

Read the full description on Focusitrecruitment's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: javascript, php, sql, html, laravel…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Swansea. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

javascriptphpsqlhtmllaravelsketch

More at Focusitrecruitment

See all open jobs at Focusitrecruitment