Senior WordPress Developer - Remote/Hybrid Role (US client)
Manilaonsitesenior
Posted 1w ago · via Workable
About this role
Role Overview: Senior WordPress Developer We are looking for an experienced Senior WordPress Developer to build, customize, and maintain secure, high-performing websites. The role focuses on WordPress development, GoHighLevel integrations, custom themes/plugins, troubleshooting, performance optimization, and delivering reliable technical solutions while collaborating with clients and teams.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, php, html, css, mysql…
2
Level fit
This role is senior-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Manila. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascriptphphtmlcssmysqlgitteams
More at MySigrid
- View →Customer Service & Order Management Specialist - (Mandarin Language Required)Manila, Metro Manila, Philippines
- View →Affiliate Content Creator - International Amazon ProductMetro Manila, Philippines
- View →Digital Marketing Specialist - Video, Media Editing & AI (Remote/Hybrid)Manila, Metro Manila, Philippines
- View →Marketing Specialist (Remote/Hybrid Role)Manila, Metro Manila, Philippines
- View →Executive Assistant (Remote-Hybrid Role)Manila, Metro Manila, Philippines
- View →User-Generated Content (UGC) CreatorDubai, Dubai, United Arab Emirates