S
SmartbrokerTechnology

Full-Stack Frontend-/Web-Developer (m/w/d)

Berlinonsitemid

via Personio

About this role

Deine Mission Du entwickelst unsere Webanwendungen im Frontend und Backend eigenverantwortlich weiter und bringst eigene Ideen zur Optimierung bestehender Lösungen ein. Dabei implementierst du neue Softwarekomponenten, sorgst für deren reibungslose Integration und arbeitest an leistungsfähigen, skalierbaren Anwendungen. Zudem verantwortest du die Wartung und Optimierung unserer Datenbankarchitekturen sowie die kontinuierliche Weiterentwicklung bestehender Software-Produkte. Mit deinem technischen Know-how, einem Blick für moderne Technologien und deinem Qualitätsanspruch trägst du maßgeblich dazu bei, unsere digitalen Lösungen zukunftssicher und performant zu gestalten.…

Read the full description on Smartbroker's site →

What we'd score you on

reqspace match rubric

Five dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.

1

Skills match

For this role: typescript, javascript, php, r, tailwind…

2

Level fit

This role is mid-level. We check your trajectory against it.

3

Domain experience

Your work in the role's domain matters more than your years total. We weight recent and direct experience.

4

Recency

A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.

5

Location fit

This role is based in Berlin. We weight your proximity and willingness to relocate.

Score yourself on this role.
Free · no card · written explanation included
See if I'm a fit →

Skills in this role

Pulled from the job description. These are the keywords we'll weight when scoring your fit.

typescriptjavascriptphprtailwindlaravelsymfony

More at Smartbroker

See all open jobs at Smartbroker