UI/UX Designer (Dashboard & Data-Driven Systems)
Ras Al-Khaimahonsitemid
Posted 6mo ago · via Workable
About this role
Job Overview: Sunreef is seeking a highly skilled UI/UX Designer with strong experience in designing data-driven dashboards and modern digital products. The ideal candidate should be proficient in industry-standard design tools, experienced with real-time (live) data interfaces, and familiar with AI-assisted design workflows, with the ability to collaborate closely with backend and engineering teams.…
What we'd score you on
reqspace match rubricFive dimensions, recruiter-grade. Upload your resume and we'll generate a written explanation of where you fit and where the gaps are.
1
Skills match
For this role: javascript, html, css, rest, figma…
2
Level fit
This role is mid-level. We check your trajectory against it.
3
Domain experience
Your work in the role's domain matters more than your years total. We weight recent and direct experience.
4
Recency
A skill you used last quarter weighs more than one from five years ago. We grade on recency, not lifetime.
5
Location fit
This role is based in Ras Al-Khaimah. We weight your proximity and willingness to relocate.
Score yourself on this role.
Free · no card · written explanation included
Skills in this role
Pulled from the job description. These are the keywords we'll weight when scoring your fit.
javascripthtmlcssrestfigmasketchadobe xdteams
More at Sunreef Yachts
- View →Senior CopywriterRas Al-Khaimah, Ras Al Khaimah, United Arab Emirates
- View →CNC Programmer (Router Machines)Adhen, Ras Al Khaimah, United Arab Emirates
- View →Upholstery SupervisorRas Al-Khaimah, Ras Al Khaimah, United Arab Emirates
- View →Painting Supervisor (Yacht Industry)Ras Al-Khaimah, Ras Al Khaimah, United Arab Emirates
- View →Interior Engineering Team LeaderRas Al-Khaimah, Ras Al Khaimah, United Arab Emirates
- View →Marine Spray PaintersRas Al-Khaimah, Ras Al Khaimah, United Arab Emirates